PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_008237925.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family NAC
Protein Properties Length: 441aa    MW: 49898.9 Da    PI: 6.8134
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_008237925.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM170.74.7e-53221491128
             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk 95 
                     lppGfrFhPtdeel+++yL+ kv + ++     i+evd++++ePw+Lp  +k +e+ewyfFs rd+ky+tg r+nrat +gyWkatgkd++v+s+
  XP_008237925.1  22 LPPGFRFHPTDEELITFYLASKVYNGSFCG-VDIAEVDLNRCEPWELPDVAKMGEREWYFFSLRDRKYPTGLRTNRATGAGYWKATGKDRQVYSA 115
                     79*************************877.34***************8888899**************************************98 PP

             NAM  96 .kgelvglkktLvfykgrapkgektdWvmheyrl 128
                      +g+l g+kktLvfykgrap+g+kt+Wvmheyrl
  XP_008237925.1 116 sTGALLGMKKTLVFYKGRAPRGHKTKWVMHEYRL 149
                     78889***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.96E-6215173IPR003441NAC domain
PROSITE profilePS5100558.75622173IPR003441NAC domain
PfamPF023651.4E-2723149IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010014Biological Processmeristem initiation
GO:0010199Biological Processorgan boundary specification between lateral organs and the meristem
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 441 aa     Download sequence    Send to blast
MLGMEDAVMS ELSGEDINEQ GLPPGFRFHP TDEELITFYL ASKVYNGSFC GVDIAEVDLN  60
RCEPWELPDV AKMGEREWYF FSLRDRKYPT GLRTNRATGA GYWKATGKDR QVYSASTGAL  120
LGMKKTLVFY KGRAPRGHKT KWVMHEYRLH GRLSSYGGHA CKDEWVICRI NHKTEDKKNP  180
LQLDQVEVEA ASSNCNCLPP LLESPTAAAK PTFLQQGQRP HQSHNPMQMQ SPHPLPPFLF  240
QHQENDLKSL INPVVSQPHL FSSFPINAFQ TQPSPSFSPT TTNSNTALLT NDKNPSPLQS  300
LLFKSLFSSH DQDCNNTIPK QCKTEPNYFS HFQTPANNNN NCDLNLLNLM EKNHHHHHHH  360
HQPNTPYHQY NNHPNDPLLF DCLDYSVLGF SDAAGTATTV HEHDTCPSTA FNRAGFQTML  420
DLPPIKVTGE SWPLDYIMDA K
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swp_D5e-511717315168NAC domain-containing protein 19
3swp_C5e-511717315168NAC domain-containing protein 19
3swp_B5e-511717315168NAC domain-containing protein 19
3swp_A5e-511717315168NAC domain-containing protein 19
3swm_D5e-511717315168NAC domain-containing protein 19
3swm_C5e-511717315168NAC domain-containing protein 19
3swm_B5e-511717315168NAC domain-containing protein 19
3swm_A5e-511717315168NAC domain-containing protein 19
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00241DAPTransfer from AT1G76420Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKR8227070.0KR822707.1 Prunus persica NAC transcription factor blood (BL) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008237925.10.0PREDICTED: protein CUP-SHAPED COTYLEDON 3
SwissprotQ9S8515e-99NAC31_ARATH; Protein CUP-SHAPED COTYLEDON 3
TrEMBLM5WDM10.0M5WDM1_PRUPE; Uncharacterized protein
STRINGPOPTR_0002s00730.11e-145(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF78883347
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G76420.11e-100NAC family protein